Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_415330 L-glutamine ABC transporter ATP binding subunit [Escherichia coli str. K-12 substr. MG1655].

Genbank/GenpeptView on NCBI
>NP_415330 L-glutamine ABC transporter ATP binding subunit [Escherichia coli str. K-12 substr. MG1655].
miefknvskhfgptqvlhnidlniaqgevvviigpsgsgkstllrcinkleeitsgdlivdglkvndpkvderlirqeagmvfqqfylfphltalenvmf
gplrvrgankeeaeklarellakvglaerahhypselsggqqqrvaiaralavkpkmmlfdeptsaldpelrhevlkvmqdlaeegmtmvivtheigfae
kvasrlifidkgriaedgnpqvliknppsqrlqeflqhvs