Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_415160 twin arginine protein translocation system - TatE protein [Escherichia coli str. K-12 substr. MG1655].


>NP_415160 twin arginine protein translocation system - TatE protein [Escherichia coli str. K-12 substr. MG1655].
mgeisitkllvvaalvvllfgtkklrtlggdlgaaikgfkkamndddaaakkgadvdlqaeklshke