Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_414835 DUF417 domain-containing inner membrane protein RclC [Escherichia coli str. K-12 substr. MG1655].

Genbank/GenpeptView on NCBI
>NP_414835 DUF417 domain-containing inner membrane protein RclC [Escherichia coli str. K-12 substr. MG1655].
mekylhllsrgdkigltlirlsiaivfmwigllkfvpyeadsitpfvansplmsffyehpedykqylthegeykpearawqtanntygfsnglgvvevii
allvlanpvnrwlgllgglmafttplvtlsflittpeawvpalgdahhgfpylsgagrlvlkdtlmlagavmimadsareilkqrsnessstlktey