Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_414650 prepilin-type N-terminal cleavage/methylation domain-containing protein PpdD [Escherichia coli str. K-12 substr. MG1655].

Genbank/GenpeptView on NCBI
>NP_414650 prepilin-type N-terminal cleavage/methylation domain-containing protein PpdD [Escherichia coli str. K-12 substr. MG1655].
mdkqrgftlielmvvigiiailsaigipayqnylrkaaltdmlqtfvpyrtavelcalehggldtcdggsngipsptttryvsamsvakgvvsltgqesl
nglsvvmtpgwdnangvtgwtrncniqsdsalqqacedvfrfddan