Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_312229 potassium-efflux system ancillary protein for KefB [Escherichia coli O157:H7 str. Sakai].


>NP_312229 potassium-efflux system ancillary protein for KefB [Escherichia coli O157:H7 str. Sakai].
msqpakvlllyahpesqdsvanrvllkpatqlsnvtvhdlyahypdffidipreqallrehevivfqhplytyscpallkewldrvlsrgfasgpggnql
agkywrsvittgepesayrydalnrypmsdvlrpfelaagmcrmhwlspiiiywarrqsaqelasharaygdwlanplspggr