Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_311745 type III secretion protein EprI [Escherichia coli O157:H7 str. Sakai].


>NP_311745 type III secretion protein EprI [Escherichia coli O157:H7 str. Sakai].
madwngyimdiskqfdqgvddlnqqvekaledlatnpsdpkflaeyqsalaeytlyrnaqsnvvkaykdldsaiiqnfr