Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_311580 pleiotropic regulatory protein for carbon source metabolism [Escherichia coli O157:H7 str. Sakai].


>NP_311580 pleiotropic regulatory protein for carbon source metabolism [Escherichia coli O157:H7 str. Sakai].
mliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhreeiyqriqaeksqqssy