Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_308523 competence-suppressing periplasmic helix-hairpin-helix DNA-binding protein [Escherichia coli O157:H7 str. Sakai].


>NP_308523 competence-suppressing periplasmic helix-hairpin-helix DNA-binding protein [Escherichia coli O157:H7 str. Sakai].
mkhgikallitlslacagmshsalaaasvakptavetkaeapaaqnkaavpakasdeegsrvsinnasaeelaramngvglkkaqaivsyreeygpfktv
edlkqvpgmgnslvernlavltl