Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_306455 type III secretion protein EpaR [Escherichia coli O157:H7 str. Sakai].


>NP_306455 type III secretion protein EpaR [Escherichia coli O157:H7 str. Sakai].
mthtivyaspviavmlggeavlgllaryasqlnafaisltvksalafliliiyfgpilaervmplsffpeqlqlyiek