Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

NP_253534 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit [Pseudomonas aeruginosa PAO1].


>NP_253534 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit [Pseudomonas aeruginosa PAO1].
mdirkvkklielleesgideleiregeesvrisrhsktaaqpvyaqapafaapvaapapaaaapaaaaaesapaapklngnvvrspmvgtfyraasptsa
nfvevgqsvkkgdilciveamkmmnhieaevsgtiesilvengqpvefdqplftiv